Lineage for d4ihjb2 (4ihj B:246-438)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420831Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1420832Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1420939Protein automated matches [227071] (2 species)
    not a true protein
  7. 1420940Species Cow (Bos taurus) [TaxId:9913] [226565] (11 PDB entries)
  8. 1420942Domain d4ihjb2: 4ihj B:246-438 [202613]
    Other proteins in same PDB: d4ihja1, d4ihjb1, d4ihjc1, d4ihjd1, d4ihje_
    automated match to d1jffb2
    complexed with adp, ca, cl, gdp, gol, gtp, mes, mg

Details for d4ihjb2

PDB Entry: 4ihj (more details), 2 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-adp complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4ihjb2:

Sequence, based on SEQRES records: (download)

>d4ihjb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d4ihjb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsraltvpeltqqmfdsknmmaacdprhgr
yltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfig
nstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda

SCOPe Domain Coordinates for d4ihjb2:

Click to download the PDB-style file with coordinates for d4ihjb2.
(The format of our PDB-style files is described here.)

Timeline for d4ihjb2: