Lineage for d4hoic_ (4hoi C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665549Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1665775Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 1665776Protein automated matches [190492] (15 species)
    not a true protein
  7. 1665822Species Mouse (Mus musculus) [TaxId:10090] [196720] (2 PDB entries)
  8. 1665825Domain d4hoic_: 4hoi C: [202455]
    automated match to d4hoid_
    complexed with so4

Details for d4hoic_

PDB Entry: 4hoi (more details), 1.85 Å

PDB Description: Crystal structure of PAS domain from the mouse EAG1 potassium channel
PDB Compounds: (C:) Potassium voltage-gated channel subfamily H member 1

SCOPe Domain Sequences for d4hoic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hoic_ d.110.3.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygeltdkdtvekvrqtf
enyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsditafk

SCOPe Domain Coordinates for d4hoic_:

Click to download the PDB-style file with coordinates for d4hoic_.
(The format of our PDB-style files is described here.)

Timeline for d4hoic_: