SCOPe 2.03: Domain d4hoib_: 4hoi B:

Lineage for d4hoib_ (4hoi B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [196720] (2 PDB entries)

8. Domain d4hoib_: 4hoi B: [202454]
   automated match to d4hoia_
   complexed with so4

Details for d4hoib_

PDB Entry: 4hoi, 1.85 Å

PDB Description: Crystal structure of PAS domain from the mouse EAG1 potassium channel

PDB Compounds: (B:) Potassium voltage-gated channel subfamily H member 1

SCOPe Domain Sequences for d4hoib_:

Sequence; same for both SEQRES and ATOM records:

>d4hoib_ d.110.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gshmtnfvlgnaqivdwpivysndgfcklsgyhraevmqkssacsfmygeltdkdtvekv
rqtfenyemnsfeilmykknrtpvwffvkiapirneqdkvvlflctfsditafk

Timeline for d4hoib_:

• d4hoib_ is new in SCOPe 2.03-stable
  
• d4hoib_ appears in SCOPe 2.04
  
• d4hoib_ appears in the current release, SCOPe 2.08, called d4hoib1