![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
![]() | Protein automated matches [190388] (31 species) not a true protein |
![]() | Species Streptomyces bikiniensis [TaxId:1896] [193359] (3 PDB entries) |
![]() | Domain d4hn1d1: 4hn1 D:1-196 [202453] Other proteins in same PDB: d4hn1a2, d4hn1b2, d4hn1c2, d4hn1d2 automated match to d4hn1a_ complexed with edo, tdr, thm, tyd; mutant |
PDB Entry: 4hn1 (more details), 1.6 Å
SCOPe Domain Sequences for d4hn1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hn1d1 b.82.1.0 (D:1-196) automated matches {Streptomyces bikiniensis [TaxId: 1896]} mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgin yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl sltddatlvflcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg llptyqawqeqqqaqr
Timeline for d4hn1d1: