Lineage for d4hhma_ (4hhm A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1345125Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1345176Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1345177Protein D-xylose isomerase [51666] (13 species)
  7. 1345339Species Streptomyces sp. [TaxId:253732] [196714] (2 PDB entries)
  8. 1345342Domain d4hhma_: 4hhm A: [202435]
    automated match to d4hhmg_
    complexed with co, mg; mutant

Details for d4hhma_

PDB Entry: 4hhm (more details), 2.15 Å

PDB Description: crystal structure of a mutant, g219a, of glucose isomerase from streptomyces sp. sk
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d4hhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhma_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces sp. [TaxId: 253732]}
nyqptpedrftfglwtvgwqgrdpfgdatrpaldpveavqrlaelgaygvtfhdddlipf
gasdtereahvkrfrqaldatgmtvpmattnlfthpvfkdgaftandrdvrryalrktir
nidlavelgakvyvawggregaesgaakdvraaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptighalafierlerpelygvnpevaheqmaglnfphgiaqalwagkl
fhidlngqsgikydqdlrfgagdlraafwlvdllesagwegprhfdfkpprtedidgvwa
saagcmrnylilkeraaafradpevqealraarldqlaeptaadglqalladrtayedfd
vdaaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d4hhma_:

Click to download the PDB-style file with coordinates for d4hhma_.
(The format of our PDB-style files is described here.)

Timeline for d4hhma_: