SCOPe 2.03: Domain d4hhlb_: 4hhl B:

Lineage for d4hhlb_ (4hhl B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.3: Xylose isomerase [51665] (2 proteins)

6. Protein D-xylose isomerase [51666] (13 species)

7. Species Streptomyces sp. [TaxId:253732] [196714] (2 PDB entries)

8. Domain d4hhlb_: 4hhl B: [202434]
   automated match to d4hhla_
   complexed with co, edo, mg

Details for d4hhlb_

PDB Entry: 4hhl, 1.73 Å

PDB Description: high resolution crystal structure of glucose isomerase from streptomyces sp. sk

PDB Compounds: (B:) xylose isomerase

SCOPe Domain Sequences for d4hhlb_:

Sequence; same for both SEQRES and ATOM records:

>d4hhlb_ c.1.15.3 (B:) D-xylose isomerase {Streptomyces sp. [TaxId: 253732]}
yqptpedrftfglwtvgwqgrdpfgdatrpaldpveavqrlaelgaygvtfhdddlipfg
asdtereahvkrfrqaldatgmtvpmattnlfthpvfkdgaftandrdvrryalrktirn
idlavelgakvyvawggregaesgaakdvraaldrmkeafdllgeyvtsqgydirfaiep
kpneprgdillptighalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
hidlngqsgikydqdlrfgagdlraafwlvdllesagwegprhfdfkpprtedidgvwas
aagcmrnylilkeraaafradpevqealraarldqlaeptaadglqalladrtayedfdv
daaaargmaferldqlamdhllgar

Timeline for d4hhlb_:

• d4hhlb_ is new in SCOPe 2.03-stable
  
• d4hhlb_ appears in SCOPe 2.04
  
• d4hhlb_ appears in the current release, SCOPe 2.08