SCOPe 2.03: Domain d4h9ua_: 4h9u A:

Lineage for d4h9ua_ (4h9u A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (16 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [189526] (9 PDB entries)

8. Domain d4h9ua_: 4h9u A: [202396]
   automated match to d4h9ub_
   complexed with fe, oh, zn

Details for d4h9ua_

PDB Entry: 4h9u, 2.1 Å

PDB Description: Structure of Geobacillus kaustophilus lactonase, wild-type with Zn2+

PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d4h9ua_:

Sequence; same for both SEQRES and ATOM records:

>d4h9ua_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyegegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptd
eervrtllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfs

Timeline for d4h9ua_:

• d4h9ua_ is new in SCOPe 2.03-stable
  
• d4h9ua_ appears in SCOPe 2.04
  
• d4h9ua_ appears in the current release, SCOPe 2.08