Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein automated matches [190068] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189507] (13 PDB entries) |
Domain d4gqsc_: 4gqs C: [202289] automated match to d4gqsb_ complexed with 0xv, gol, hem |
PDB Entry: 4gqs (more details), 2.87 Å
SCOPe Domain Sequences for d4gqsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gqsc_ a.104.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvlhgyevvkeali dlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmgkrsiedrvqee arclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnlmeklneniriv stpwiqicnnfptiidyfpgthnkllknlafmesdilekvkehqesmdinnprdfidcfl ikmekekqnqqseftienlvitaadllgagtettsttlryalllllkhpevtakvqeeie rvvgrnrspcmqdrghmpytdavvhevqryidliptslphavtcdvkfrnylipkgttil tsltsvlhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvgeglarmelflf ltfilqnfnlkslidpkdldttpvvngfasvppfyqlcfipi
Timeline for d4gqsc_: