Lineage for d4ggfl_ (4ggf L:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1268673Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1268868Protein automated matches [190132] (3 species)
    not a true protein
  7. 1268871Species Human (Homo sapiens) [TaxId:9606] [187203] (20 PDB entries)
  8. 1268888Domain d4ggfl_: 4ggf L: [202263]
    Other proteins in same PDB: d4ggfa_, d4ggfk_, d4ggfs_, d4ggfu_
    automated match to d3nsib_
    complexed with ca, gol, mn, so4

Details for d4ggfl_

PDB Entry: 4ggf (more details), 1.6 Å

PDB Description: Crystal structure of Mn2+ bound calprotectin
PDB Compounds: (L:) Protein S100-A9

SCOPe Domain Sequences for d4ggfl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ggfl_ a.39.1.2 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgeg

SCOPe Domain Coordinates for d4ggfl_:

Click to download the PDB-style file with coordinates for d4ggfl_.
(The format of our PDB-style files is described here.)

Timeline for d4ggfl_: