![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
![]() | Species Escherichia coli [TaxId:562] [56259] (8 PDB entries) |
![]() | Domain d4g4ej_: 4g4e J: [202180] automated match to d4g4ee_ mutant |
PDB Entry: 4g4e (more details), 2.89 Å
SCOPe Domain Sequences for d4g4ej_:
Sequence, based on SEQRES records: (download)
>d4g4ej_ d.153.1.4 (J:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrtdrmarkleallavadetasliitgngdvvqpendli aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
>d4g4ej_ d.153.1.4 (J:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrrkleallavadetasliitgngdvvqpendliaigsg gpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk
Timeline for d4g4ej_: