Lineage for d4fn4d_ (4fn4 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2457051Species Sulfolobus acidocaldarius [TaxId:330779] [196955] (1 PDB entry)
  8. 2457055Domain d4fn4d_: 4fn4 D: [202062]
    automated match to d4fn4a_
    complexed with gol, nad, so4

Details for d4fn4d_

PDB Entry: 4fn4 (more details), 1.75 Å

PDB Description: short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius
PDB Compounds: (D:) Short chain dehydrogenase

SCOPe Domain Sequences for d4fn4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fn4d_ c.2.1.0 (D:) automated matches {Sulfolobus acidocaldarius [TaxId: 330779]}
syqslknkvvivtgagsgigraiakkfalndsivvavelledrlnqivqelrgmgkevlg
vkadvskkkdveefvrrtfetysridvlcnnagimdgvtpvaevsdelwervlavnlysa
fyssravipimlkqgkgvivntasiagirggfagapytvakhgligltrsiaahygdqgi
ravavlpgtvktniglgsskpselgmrtltklmslssrlaepedianvivflasdeasfv
ngdavvvdggltvl

SCOPe Domain Coordinates for d4fn4d_:

Click to download the PDB-style file with coordinates for d4fn4d_.
(The format of our PDB-style files is described here.)

Timeline for d4fn4d_: