Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Sulfolobus acidocaldarius [TaxId:330779] [196955] (1 PDB entry) |
Domain d4fn4d_: 4fn4 D: [202062] automated match to d4fn4a_ complexed with gol, nad, so4 |
PDB Entry: 4fn4 (more details), 1.75 Å
SCOPe Domain Sequences for d4fn4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fn4d_ c.2.1.0 (D:) automated matches {Sulfolobus acidocaldarius [TaxId: 330779]} syqslknkvvivtgagsgigraiakkfalndsivvavelledrlnqivqelrgmgkevlg vkadvskkkdveefvrrtfetysridvlcnnagimdgvtpvaevsdelwervlavnlysa fyssravipimlkqgkgvivntasiagirggfagapytvakhgligltrsiaahygdqgi ravavlpgtvktniglgsskpselgmrtltklmslssrlaepedianvivflasdeasfv ngdavvvdggltvl
Timeline for d4fn4d_: