Lineage for d4f6ra1 (4f6r A:1-245)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592224Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1592225Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1592226Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1592334Protein automated matches [226837] (3 species)
    not a true protein
  7. 1592390Species Sheep (Ovis aries) [TaxId:9940] [224884] (9 PDB entries)
  8. 1592409Domain d4f6ra1: 4f6r A:1-245 [202007]
    Other proteins in same PDB: d4f6ra2, d4f6rb2, d4f6rd_
    automated match to d1z2ba1
    complexed with gdp, gtp, mes, mg, so4

Details for d4f6ra1

PDB Entry: 4f6r (more details), 2.64 Å

PDB Description: Tubulin:Stathmin-like domain complex
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d4f6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f6ra1 c.32.1.1 (A:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d4f6ra1:

Click to download the PDB-style file with coordinates for d4f6ra1.
(The format of our PDB-style files is described here.)

Timeline for d4f6ra1: