SCOPe 2.04: Domain d4e1of_: 4e1o F:

Lineage for d4e1of_ (4e1o F:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (83 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188446] (17 PDB entries)

8. Domain d4e1of_: 4e1o F: [201770]
   automated match to d4e1oc_
   complexed with plp, pvh

Details for d4e1of_

PDB Entry: 4e1o, 1.8 Å

PDB Description: Human histidine decarboxylase complex with Histidine methyl ester (HME)

PDB Compounds: (F:) histidine decarboxylase

SCOPe Domain Sequences for d4e1of_:

Sequence; same for both SEQRES and ATOM records:

>d4e1of_ c.67.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmepeeyrergremvdyicqylstvrerrvtpdvqpgylraqlpesapedpdswdsifg
dieriimpgvvhwqsphmhayypaltswpsllgdmladainclgftwasspactelemnv
mdwlakmlglpehflhhhpssqgggvlqstvsestliallaarknkilemktsepdades
slnarlvayasdqahssvekaglislvkmkflpvddnfslrgealqkaieedkqrglvpv
fvcatlgttgvcafdclselgpicareglwlhidaayagtaflcpefrgflkgieyadsf
tfnpskwmmvhfdctgfwvkdkyklqqtfsvnpiylrhansgvatdfmhwqiplsrrfrs
vklwfvirsfgvknlqahvrhgtemakyfeslvrndpsfeipakrhlglvvfrlkgpnsl
tenvlkeiakagrlflipatiqdkliirftvtsqfttrddilrdwnlirdaatlilsq

Timeline for d4e1of_:

• d4e1of_ first appeared in SCOPe 2.03
  
• d4e1of_ appears in SCOPe 2.05
  
• d4e1of_ appears in the current release, SCOPe 2.08, called d4e1of1