Lineage for d4b9kg_ (4b9k G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538361Protein Elongin B [54246] (2 species)
  7. 2538362Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries)
  8. 2538369Domain d4b9kg_: 4b9k G: [201597]
    Other proteins in same PDB: d4b9kb1, d4b9kb2, d4b9kc_, d4b9ke_, d4b9kf_, d4b9kh_, d4b9ki_, d4b9kk1, d4b9kk2, d4b9kl_
    automated match to d4awjg_
    complexed with act, tg0

Details for d4b9kg_

PDB Entry: 4b9k (more details), 2 Å

PDB Description: pvhl-elob-eloc complex_(2s,4r)-1-(3-amino-2-methylbenzoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide bound
PDB Compounds: (G:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4b9kg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b9kg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4b9kg_:

Click to download the PDB-style file with coordinates for d4b9kg_.
(The format of our PDB-style files is described here.)

Timeline for d4b9kg_: