Class b: All beta proteins [48724] (178 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (20 species) not a true protein |
Species Influenza A virus (a/california/07/2009(h1n1)) [TaxId:641809] [193484] (3 PDB entries) |
Domain d4b7rd_: 4b7r D: [201580] automated match to d4b7rb_ complexed with ca, epe, g39, nag; mutant |
PDB Entry: 4b7r (more details), 1.9 Å
SCOPe Domain Sequences for d4b7rd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b7rd_ b.68.1.0 (D:) automated matches {Influenza A virus (a/california/07/2009(h1n1)) [TaxId: 641809]} vklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgallnd khsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdnga vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekgk ivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgif gdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwtg tdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgss isfcgvnsdtvgwswpdgaelpftidk
Timeline for d4b7rd_: