SCOPe 2.07: Domain d4aq3a_: 4aq3 A:

Lineage for d4aq3a_ (4aq3 A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (88 PDB entries)

8. Domain d4aq3a_: 4aq3 A: [201495]
   automated match to d4aq3b_
   complexed with 398

Details for d4aq3a_

PDB Entry: 4aq3, 2.4 Å

PDB Description: human bcl-2 with phenylacylsulfonamide inhibitor

PDB Compounds: (A:) apoptosis regulator bcl-2, bcl-2-like protein 1

SCOPe Domain Sequences for d4aq3a_:

Sequence, based on SEQRES records:

>d4aq3a_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhlalrqagddfsrryr
gdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremspl
vdnialwmteylnrhlhtwiqdnggwdafvelyg

Sequence, based on observed residues (ATOM records):

>d4aq3a_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdvvhlalrqagddfsrryrgdfaemssqlhltpftarg
rfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteylnrhlhtw
iqdnggwdafvelyg

Timeline for d4aq3a_:

• d4aq3a_ first appeared in SCOPe 2.03
  
• d4aq3a_ appears in SCOPe 2.06
  
• d4aq3a_ appears in the current release, SCOPe 2.08