![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries) Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10 |
![]() | Domain d1fj1d1: 1fj1 D:1-114 [20121] Other proteins in same PDB: d1fj1a1, d1fj1a2, d1fj1b2, d1fj1c1, d1fj1c2, d1fj1d2, d1fj1e_, d1fj1f_ part of Fab LA-2 against OspA |
PDB Entry: 1fj1 (more details), 2.68 Å
SCOPe Domain Sequences for d1fj1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fj1d1 b.1.1.1 (D:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} qiqlvqsgpelkkpgetvkisckasgytftdysmywvkqapgkglkrmgwintetgepty addfkgrfalsldtsastaylhisnlknedtatyfcargldswgqgtsvtvssa
Timeline for d1fj1d1: