Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (3 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [224884] (9 PDB entries) |
Domain d3ut5b1: 3ut5 B:1-245 [201113] Other proteins in same PDB: d3ut5a2, d3ut5b2, d3ut5c2, d3ut5d2, d3ut5e_ automated match to d1z2bb1 complexed with gdp, gtp, loc, mg, so4 |
PDB Entry: 3ut5 (more details), 2.73 Å
SCOPe Domain Sequences for d3ut5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ut5b1 c.32.1.1 (B:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d3ut5b1: