Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [193333] (3 PDB entries) |
Domain d3uoil_: 3uoi L: [201085] automated match to d3uoiw_ complexed with hem |
PDB Entry: 3uoi (more details), 1.9 Å
SCOPe Domain Sequences for d3uoil_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uoil_ a.25.1.0 (L:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll ekivadeeehidyletqlelmdklgeelysaqcvsrppt
Timeline for d3uoil_: