Lineage for d3unfu_ (3unf U:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2597114Species Mouse (Mus musculus) [TaxId:10090] [195927] (2 PDB entries)
  8. 2597116Domain d3unfu_: 3unf U: [201070]
    Other proteins in same PDB: d3unfa_, d3unfb_, d3unfc_, d3unfd_, d3unfe_, d3unff_, d3unfh_, d3unfi_, d3unfj_, d3unfk_, d3unfl_, d3unfm_, d3unfn_, d3unfo_, d3unfp_, d3unfq_, d3unfr_, d3unfs_, d3unft_, d3unfv_, d3unfw_, d3unfx_, d3unfy_, d3unfz_
    automated match to d3unbu_
    complexed with 04c, cl, iod, k

Details for d3unfu_

PDB Entry: 3unf (more details), 2.9 Å

PDB Description: Mouse 20S immunoproteasome in complex with PR-957
PDB Compounds: (U:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d3unfu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unfu_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Mouse (Mus musculus) [TaxId: 10090]}
srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkll
dsstvthlfkitesigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
sqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflek
kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
lae

SCOPe Domain Coordinates for d3unfu_:

Click to download the PDB-style file with coordinates for d3unfu_.
(The format of our PDB-style files is described here.)

Timeline for d3unfu_: