Lineage for d3unbf_ (3unb F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439412Species Mouse (Mus musculus) [TaxId:10090] [195917] (2 PDB entries)
  8. 1439438Domain d3unbf_: 3unb F: [201039]
    Other proteins in same PDB: d3unbe_, d3unbg_, d3unbs_, d3unbu_
    automated match to d3unbt_
    complexed with 04c

Details for d3unbf_

PDB Entry: 3unb (more details), 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957
PDB Compounds: (F:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d3unbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unbf_ d.153.1.4 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyee
gsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvh
aytlysavrpfgcsfmlgsysandgaqlymidpsgvsygywgcaigkarqaakteieklq
mkemtcrdvvkevakiiyivhdevkdkafelelswvgeltkgrheivpkdireeaekyak
eslk

SCOPe Domain Coordinates for d3unbf_:

Click to download the PDB-style file with coordinates for d3unbf_.
(The format of our PDB-style files is described here.)

Timeline for d3unbf_: