![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) ![]() automatically mapped to Pfam PF04062 |
![]() | Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
![]() | Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [69063] (5 PDB entries) Uniprot O15145 # 100% sequence identity |
![]() | Domain d3ulee_: 3ule E: [201011] Other proteins in same PDB: d3ulea1, d3ulea2, d3uleb1, d3ulec_, d3uled1, d3uled2, d3ulef_, d3uleg_ automated match to d1k8ke_ complexed with atp, c69, ca |
PDB Entry: 3ule (more details), 2.5 Å
SCOPe Domain Sequences for d3ulee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ulee_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
Timeline for d3ulee_: