Class g: Small proteins [56992] (91 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.0: automated matches [191505] (1 protein) not a true family |
Protein automated matches [190829] (11 species) not a true protein |
Species Pseudonaja textilis [TaxId:169397] [188742] (4 PDB entries) |
Domain d3uird_: 3uir D: [200989] Other proteins in same PDB: d3uira_, d3uirb_ automated match to d3bybb_ complexed with so4 |
PDB Entry: 3uir (more details), 2.78 Å
SCOPe Domain Sequences for d3uird_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uird_ g.8.1.0 (D:) automated matches {Pseudonaja textilis [TaxId: 169397]} rpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa
Timeline for d3uird_: