SCOP 1.61: Domain d1vgeh1: 1vge H:1-122

Lineage for d1vgeh1 (1vge H:1-122)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab TR1.9 (mouse/human), kappa L chain [48812] (1 PDB entry)

8. Domain d1vgeh1: 1vge H:1-122 [20095]
   Other proteins in same PDB: d1vgeh2, d1vgel2

Details for d1vgeh1

PDB Entry: 1vge, 2 Å

PDB Description: tr1.9 fab fragment of a human igg1 kappa autoantibody

SCOP Domain Sequences for d1vgeh1:

Sequence; same for both SEQRES and ATOM records:

>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin (variable domains of L and H chains) {Fab TR1.9 (mouse/human), kappa L chain}
qvklleqsgaevkkpgasvkvsckasgysftsyglhwvrqapgqrlewmgwisagtgntk
ysqkfrgrvtftrdtsattaymglsslrpedtavyycardpygggksefdywgqgtlvtv
ss

Timeline for d1vgeh1:

• d1vgeh1 first appeared (with stable ids) in SCOP 1.55
  
• d1vgeh1 appears in SCOP 1.59
  
• d1vgeh1 appears in SCOP 1.63
  
• d1vgeh1 appears in the current release, SCOPe 2.08