Lineage for d3tqfa_ (3tqf A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1389759Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 1389760Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 1389865Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 1389866Protein automated matches [196142] (4 species)
    not a true protein
  7. 1389884Species Coxiella burnetii [TaxId:777] [196143] (1 PDB entry)
  8. 1389885Domain d3tqfa_: 3tqf A: [200859]
    automated match to d3tqfb_
    complexed with po4

Details for d3tqfa_

PDB Entry: 3tqf (more details), 2.8 Å

PDB Description: structure of the hpr(ser) kinase/phosphatase from coxiella burnetii
PDB Compounds: (A:) Hpr(Ser) kinase

SCOPe Domain Sequences for d3tqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqfa_ c.91.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
kqtwhanflvidkmgvlitgeanigkselslalidrghqlvcddvidlkqennqligscp
svangyilitgigiidvpklfgldavvnqhevhlsislvkpekmpllddplnplyrteii
lginvpkilfpihpgrnlpllietlvrnhrlkmegydsshhfheh

SCOPe Domain Coordinates for d3tqfa_:

Click to download the PDB-style file with coordinates for d3tqfa_.
(The format of our PDB-style files is described here.)

Timeline for d3tqfa_: