Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d3t3pf1: 3t3p F:1-107 [200747] Other proteins in same PDB: d3t3pa_, d3t3pc_, d3t3pf2, d3t3pl2 automated match to d1dqdl1 complexed with bma, ca, cl, gol, man, mg, nag, so4 |
PDB Entry: 3t3p (more details), 2.2 Å
SCOPe Domain Sequences for d3t3pf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t3pf1 b.1.1.0 (F:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik
Timeline for d3t3pf1:
View in 3D Domains from other chains: (mouse over for more information) d3t3pa_, d3t3pc_, d3t3pl1, d3t3pl2 |