Lineage for d3sw5e_ (3sw5 E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1315663Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 1315791Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 1315792Protein automated matches [190523] (10 species)
    not a true protein
  7. 1315796Species Bartonella henselae [TaxId:38323] [196244] (1 PDB entry)
  8. 1315801Domain d3sw5e_: 3sw5 E: [200716]
    automated match to d3sw5f_
    complexed with lmr

Details for d3sw5e_

PDB Entry: 3sw5 (more details), 2 Å

PDB Description: crystal structure of inorganic pyrophosphatase from bartonella henselae
PDB Compounds: (E:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3sw5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sw5e_ b.40.5.0 (E:) automated matches {Bartonella henselae [TaxId: 38323]}
ikeiavgknppedvnvivevslggqpikyemdkksgalfvdrflytsmvypgnygfvpht
lsedgdpidvlicntrpllpgcvinvypigalimeddggkdekiiaiptpkltqrynnih
dytdlpeitlkqiehffehykdlepgkwakiegwrdksfahelikqaiernk

SCOPe Domain Coordinates for d3sw5e_:

Click to download the PDB-style file with coordinates for d3sw5e_.
(The format of our PDB-style files is described here.)

Timeline for d3sw5e_: