SCOPe 2.04: Domain d3svob_: 3svo B:

Lineage for d3svob_ (3svo B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [189424] (7 PDB entries)

8. Domain d3svob_: 3svo B: [200707]
   automated match to d3svod_
   mutant

Details for d3svob_

PDB Entry: 3svo, 1.98 Å

PDB Description: Crystal structure of mKate mutant S158A/S143C at pH 10.0

PDB Compounds: (B:) mkate S158A/S143C

SCOPe Domain Sequences for d3svob_:

Sequence; same for both SEQRES and ATOM records:

>d3svob_ d.22.1.1 (B:) automated matches {Artificial gene [TaxId: 32630]}
alitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafdilatsf
mygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
gvnfpsngpvmqkktlgweactemlypadgglegradmalklvggghlicnlkttyrskk
paknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpsklahk

Timeline for d3svob_:

• d3svob_ first appeared in SCOPe 2.03
  
• d3svob_ appears in SCOPe 2.05
  
• d3svob_ appears in the current release, SCOPe 2.08