Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (3 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [224884] (7 PDB entries) |
Domain d3ryid1: 3ryi D:1-245 [200567] Other proteins in same PDB: d3ryia2, d3ryib2, d3ryic2, d3ryid2, d3ryie_ automated match to d1z2bb1 complexed with gdp, gtp, mg, so4 |
PDB Entry: 3ryi (more details), 2.4 Å
SCOPe Domain Sequences for d3ryid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ryid1 c.32.1.1 (D:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d3ryid1: