SCOPe 2.04: Domain d3ryia2: 3ryi A:246-438

Lineage for d3ryia2 (3ryi A:246-438)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (2 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (9 PDB entries)

8. Domain d3ryia2: 3ryi A:246-438 [200562]
   Other proteins in same PDB: d3ryia1, d3ryib1, d3ryic1, d3ryid1, d3ryie_
   automated match to d1z2ba2
   complexed with gdp, gtp, mg, so4

Details for d3ryia2

PDB Entry: 3ryi, 2.4 Å

PDB Description: GDP-Tubulin: rb3 stathmin-like domain complex

PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d3ryia2:

Sequence; same for both SEQRES and ATOM records:

>d3ryia2 d.79.2.1 (A:246-438) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

Timeline for d3ryia2:

• d3ryia2 first appeared in SCOPe 2.03
  
• d3ryia2 appears in SCOPe 2.05
  
• d3ryia2 appears in the current release, SCOPe 2.08