SCOPe 2.07: Domain d3rseb_: 3rse B:

Lineage for d3rseb_ (3rse B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin-related protein 2, Arp2 [69530] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69531] (14 PDB entries)
   Uniprot P61160 143-350 # 100% sequence identity

8. Domain d3rseb_: 3rse B: [200509]
   Other proteins in same PDB: d3rsea1, d3rsea2, d3rsec_, d3rsed1, d3rsed2, d3rsee_, d3rsef_, d3rseg_
   automated match to d1u2vb1

Details for d3rseb_

PDB Entry: 3rse, 2.65 Å

PDB Description: Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex

PDB Compounds: (B:) Actin-related Protein 2

SCOPe Domain Sequences for d3rseb_:

Sequence; same for both SEQRES and ATOM records:

>d3rseb_ c.55.1.1 (B:) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]}
gvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhsadfetv
rmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfqphlinv
egvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlylervlkgd
veklskfkiriedppr

Timeline for d3rseb_:

• d3rseb_ first appeared in SCOPe 2.03
  
• d3rseb_ appears in SCOPe 2.06
  
• d3rseb_ appears in the current release, SCOPe 2.08