Lineage for d3rd1a_ (3rd1 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595370Protein automated matches [190047] (24 species)
    not a true protein
  7. 1595403Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [196360] (1 PDB entry)
  8. 1595404Domain d3rd1a_: 3rd1 A: [200466]
    automated match to d3rd1b_
    complexed with gdp, mg

Details for d3rd1a_

PDB Entry: 3rd1 (more details), 1.8 Å

PDB Description: structure of an adp ribosylation factor from entamoeba histolytica hm- 1:imss bound to mg-gdp
PDB Compounds: (A:) ADP-ribosylation factor

SCOPe Domain Sequences for d3rd1a_:

Sequence, based on SEQRES records: (download)

>d3rd1a_ c.37.1.8 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
dvggqdkirplwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfan
khdlpqamsisevteklglqtiknrkwycqtscatngdglyegldwladnl

Sequence, based on observed residues (ATOM records): (download)

>d3rd1a_ c.37.1.8 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw
dvggplwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfankhdlp
qamsisevteklglqtiknrkwycqtscatngdglyegldwladnl

SCOPe Domain Coordinates for d3rd1a_:

Click to download the PDB-style file with coordinates for d3rd1a_.
(The format of our PDB-style files is described here.)

Timeline for d3rd1a_: