SCOPe 2.08: Domain d3q3gj2: 3q3g J:114-220

Lineage for d3q3gj2 (3q3g J:114-220)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3q3gj2: 3q3g J:114-220 [200285]
   Other proteins in same PDB: d3q3ga1, d3q3gb1, d3q3gb2, d3q3gc1, d3q3gd1, d3q3gd2, d3q3ge_, d3q3gf1, d3q3gg_, d3q3gh1, d3q3gh2, d3q3gi_, d3q3gj1, d3q3gk1, d3q3gk2, d3q3gl_
   automated match to d1dqdl2
   complexed with ca, cl, edo, gol, na, peg

Details for d3q3gj2

PDB Entry: 3q3g, 2.7 Å

PDB Description: Crystal Structure of A-domain in complex with antibody

PDB Compounds: (J:) Antibody Light Chain

SCOPe Domain Sequences for d3q3gj2:

Sequence; same for both SEQRES and ATOM records:

>d3q3gj2 b.1.1.2 (J:114-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3q3gj2:

• d3q3gj2 first appeared in SCOPe 2.03
  
• d3q3gj2 appears in SCOPe 2.07