SCOPe 2.03: Domain d3q1sl2: 3q1s L:108-211

Lineage for d3q1sl2 (3q1s L:108-211)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3q1sl2: 3q1s L:108-211 [200274]
   Other proteins in same PDB: d3q1si_
   automated match to d1c5da2
   complexed with gol, ipa

Details for d3q1sl2

PDB Entry: 3q1s, 2.15 Å

PDB Description: HIV-1 neutralizing antibody Z13e1 in complex with epitope display protein

PDB Compounds: (L:) Z13e1 Fab light chain

SCOPe Domain Sequences for d3q1sl2:

Sequence; same for both SEQRES and ATOM records:

>d3q1sl2 b.1.1.0 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3q1sl2:

• d3q1sl2 is new in SCOPe 2.03-stable
  
• d3q1sl2 appears in SCOPe 2.04
  
• d3q1sl2 appears in the current release, SCOPe 2.08