Lineage for d3pwnd1 (3pwn D:1-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406058Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1406071Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
    Uniprot P01892 25-298
  8. 1406079Domain d3pwnd1: 3pwn D:1-181 [200265]
    Other proteins in same PDB: d3pwna2, d3pwnb_, d3pwnd2, d3pwne_
    automated match to d1i4fa2
    complexed with gol

Details for d3pwnd1

PDB Entry: 3pwn (more details), 1.6 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the HuD (G2L) peptide variant
PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3pwnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwnd1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3pwnd1:

Click to download the PDB-style file with coordinates for d3pwnd1.
(The format of our PDB-style files is described here.)

Timeline for d3pwnd1: