Lineage for d3puvf1 (3puv F:10-260)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1695472Fold e.70: MalF N-terminal region-like [160963] (1 superfamily)
    consists of 3 N-terminal transmembrane helices, an alpha+beta linker domain and a beta-barrel (n=7; S=8) with one overside loop
  4. 1695473Superfamily e.70.1: MalF N-terminal region-like [160964] (1 family) (S)
  5. 1695474Family e.70.1.1: MalF N-terminal region-like [160965] (1 protein)
    PfamB PB001917
  6. 1695475Protein Maltose transport system permease protein MalF [160966] (1 species)
  7. 1695476Species Escherichia coli [TaxId:562] [160967] (10 PDB entries)
    Uniprot P02916 13-260
  8. 1695480Domain d3puvf1: 3puv F:10-260 [200234]
    Other proteins in same PDB: d3puva1, d3puva2, d3puvb1, d3puvb2, d3puve_, d3puvf2, d3puvg_
    automated match to d2r6gf1
    complexed with adp, mal, mg, pgv, umq, vo4

Details for d3puvf1

PDB Entry: 3puv (more details), 2.4 Å

PDB Description: crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4
PDB Compounds: (F:) Maltose transport system permease protein malF

SCOPe Domain Sequences for d3puvf1:

Sequence, based on SEQRES records: (download)

>d3puvf1 e.70.1.1 (F:10-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wqsdalkwsvlgllgllvgylvvlmyaqgeylfaittlilssaglyifanrkayawryvy
pgmagmglfvlfplvctiaiaftnysstnqltferaqevlldrswqagktynfglypagd
ewqlalsdgetgknylsdafkfggeqklqlkettaqpegeranlrvitqnrqalsditai
lpdgnkvmmsslrqfsgtqplytldgdgtltnnqsgvkyrpnnqigfyqsitadgnwgde
klspgytvttg

Sequence, based on observed residues (ATOM records): (download)

>d3puvf1 e.70.1.1 (F:10-260) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wqsdalkwsvlgllgllvgylvvlmyaqgeylfaittlilssaglyifanrkayawryvy
pgmagmglfvlfplvctiaiaftnysstnqltferaqevlldrswqagktynfglypagd
ewqlalsdgetgknylsdafkfggeqklqlkettaqpegeranlrvitqnrqalsditai
lpdgnkvmmsslrqfsgtqplytldgdgtltnnqsgvkyrpnnqigfyqsinwgdeklsp
gytvttg

SCOPe Domain Coordinates for d3puvf1:

Click to download the PDB-style file with coordinates for d3puvf1.
(The format of our PDB-style files is described here.)

Timeline for d3puvf1: