Lineage for d1mrfl1 (1mrf L:1-108)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52413Species Fab Jel 103 (mouse), kappa L chain [48794] (4 PDB entries)
  8. 52419Domain d1mrfl1: 1mrf L:1-108 [20020]
    Other proteins in same PDB: d1mrfh2, d1mrfl2

Details for d1mrfl1

PDB Entry: 1mrf (more details), 2.4 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrfl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikr

SCOP Domain Coordinates for d1mrfl1:

Click to download the PDB-style file with coordinates for d1mrfl1.
(The format of our PDB-style files is described here.)

Timeline for d1mrfl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrfl2