Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab Jel 103 (mouse), kappa L chain [48794] (4 PDB entries) |
Domain d1mrfl1: 1mrf L:1-108 [20020] Other proteins in same PDB: d1mrfh2, d1mrfl2 |
PDB Entry: 1mrf (more details), 2.4 Å
SCOP Domain Sequences for d1mrfl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mrfl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain} dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikr
Timeline for d1mrfl1: