SCOPe 2.08: Domain d3o9wa2: 3o9w A:186-279

Lineage for d3o9wa2 (3o9w A:186-279)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein CD1, alpha-3 domain [88615] (5 species)
Species Mouse (Mus musculus) [TaxId:10090] [88616] (12 PDB entries)
Domain d3o9wa2: 3o9w A:186-279 [200026]
Other proteins in same PDB: d3o9wa1, d3o9wb_, d3o9wc1, d3o9wc2, d3o9wd1, d3o9wd2
automated match to d1onqa1
complexed with 1o2, nag

Details for d3o9wa2

PDB Entry: 3o9w (more details), 2.8 Å

PDB Description: recognition of a glycolipid antigen by the inkt cell tcr

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3o9wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9wa2 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3o9wa2:

Click to download the PDB-style file with coordinates for d3o9wa2.
(The format of our PDB-style files is described here.)

Timeline for d3o9wa2: