Lineage for d3mg7d_ (3mg7 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602159Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2602190Domain d3mg7d_: 3mg7 D: [199842]
    Other proteins in same PDB: d3mg71_, d3mg72_, d3mg7a_, d3mg7b_, d3mg7c_, d3mg7e_, d3mg7f_, d3mg7g_, d3mg7h_, d3mg7i_, d3mg7j_, d3mg7k_, d3mg7l_, d3mg7m_, d3mg7n_, d3mg7o_, d3mg7p_, d3mg7q_, d3mg7s_, d3mg7t_, d3mg7u_, d3mg7v_, d3mg7w_, d3mg7x_, d3mg7y_, d3mg7z_
    automated match to d4eu2f_
    complexed with l2t, mes, mg

Details for d3mg7d_

PDB Entry: 3mg7 (more details), 2.78 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 8
PDB Compounds: (D:) Proteasome component PUP2

SCOPe Domain Sequences for d3mg7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg7d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d3mg7d_:

Click to download the PDB-style file with coordinates for d3mg7d_.
(The format of our PDB-style files is described here.)

Timeline for d3mg7d_: