Lineage for d3kprd1 (3kpr D:2-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741896Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2741897Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (21 PDB entries)
  8. 2741919Domain d3kprd1: 3kpr D:2-117 [199645]
    Other proteins in same PDB: d3kpra1, d3kpra2, d3kprb_, d3kprd2, d3kpre2, d3kprf1, d3kprf2, d3kprg_, d3kpri2, d3kprj2
    automated match to d1mi5d1

Details for d3kprd1

PDB Entry: 3kpr (more details), 2.6 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylkawtf a mimotope
PDB Compounds: (D:) LC13 TCR alpha chain

SCOPe Domain Sequences for d3kprd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kprd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
kttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrmasl
aiaedrksstlilhratlrdaavyycilplaggtsygkltfgqgtiltvhpn

SCOPe Domain Coordinates for d3kprd1:

Click to download the PDB-style file with coordinates for d3kprd1.
(The format of our PDB-style files is described here.)

Timeline for d3kprd1: