SCOPe 2.04: Domain d3hb3b2: 3hb3 B:108-252

Lineage for d3hb3b2 (3hb3 B:108-252)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Paracoccus denitrificans [TaxId:266] [49546] (4 PDB entries)

8. Domain d3hb3b2: 3hb3 B:108-252 [199494]
   Other proteins in same PDB: d3hb3a_, d3hb3b1, d3hb3c_, d3hb3d_
   automated match to d1ar1b1
   complexed with ca, cu1, hea, lda, lmt, mn, peo

Details for d3hb3b2

PDB Entry: 3hb3, 2.25 Å

PDB Description: High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3hb3b2:

Sequence; same for both SEQRES and ATOM records:

>d3hb3b2 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa

Timeline for d3hb3b2:

• d3hb3b2 first appeared in SCOPe 2.03
  
• d3hb3b2 appears in SCOPe 2.05
  
• d3hb3b2 appears in the current release, SCOPe 2.08