Lineage for d3hb3b1 (3hb3 B:1-107)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577253Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2577295Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2577296Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2577297Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)
  7. 2577298Species Paracoccus denitrificans [TaxId:266] [81456] (4 PDB entries)
  8. 2577299Domain d3hb3b1: 3hb3 B:1-107 [199493]
    Other proteins in same PDB: d3hb3a_, d3hb3b2, d3hb3c_, d3hb3d_
    automated match to d1ar1b2
    complexed with ca, cu1, hea, lda, lmt, mn, peo

Details for d3hb3b1

PDB Entry: 3hb3 (more details), 2.25 Å

PDB Description: High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3hb3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hb3b1 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans [TaxId: 266]}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp

SCOPe Domain Coordinates for d3hb3b1:

Click to download the PDB-style file with coordinates for d3hb3b1.
(The format of our PDB-style files is described here.)

Timeline for d3hb3b1: