Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries) Uniprot P01901 22-299 |
Domain d3e6fa2: 3e6f A:182-274 [199314] Other proteins in same PDB: d3e6fa1, d3e6fb_ automated match to d1ddha1 |
PDB Entry: 3e6f (more details), 2.41 Å
SCOPe Domain Sequences for d3e6fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e6fa2 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdppkahvthhrrpegdvtlrcwalgfypaditltwqlngeeltqemelvetrpagdgtf qkwasvvvplgkeqkytchveheglpepltlrw
Timeline for d3e6fa2: