Lineage for d2vitb1 (2vit B:1-120)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547125Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 547169Domain d2vitb1: 2vit B:1-120 [19915]
    Other proteins in same PDB: d2vita1, d2vita2, d2vitb2, d2vitc_
    part of Fab HC19
    complexed with zn; mutant

Details for d2vitb1

PDB Entry: 2vit (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, mutant with thr 155 replaced by ile, complexed with a neutralizing antibody

SCOP Domain Sequences for d2vitb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vitb1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5}
qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv

SCOP Domain Coordinates for d2vitb1:

Click to download the PDB-style file with coordinates for d2vitb1.
(The format of our PDB-style files is described here.)

Timeline for d2vitb1: