Lineage for d3bz2c_ (3bz2 C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2634050Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2634051Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2634052Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 2634064Protein Photosystem II CP43 protein PsbC [161081] (2 species)
  7. 2634065Species Thermosynechococcus elongatus [TaxId:146786] [161082] (3 PDB entries)
    Uniprot Q8DIF8 15-461
  8. 2634066Domain d3bz2c_: 3bz2 C: [199137]
    Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2x_, d3bz2z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2c_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (C:) Photosystem II CP43 protein

SCOPe Domain Sequences for d3bz2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2c_ f.55.1.1 (C:) Photosystem II CP43 protein PsbC {Thermosynechococcus elongatus [TaxId: 146786]}
dqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqgl
iliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyssf
fgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptldp
rvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafiw
sgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklga
nvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiqp
wqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwhag
raraaaagfekgidresepvlsmpsld

SCOPe Domain Coordinates for d3bz2c_:

Click to download the PDB-style file with coordinates for d3bz2c_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2c_: