Lineage for d3bz1t_ (3bz1 T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026547Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 3026548Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 3026549Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 3026550Species Thermosynechococcus elongatus [TaxId:146786] [161032] (11 PDB entries)
    Uniprot Q8DIQ0 1-30
  8. 3026560Domain d3bz1t_: 3bz1 T: [199135]
    Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1u_, d3bz1v_, d3bz1x_, d3bz1z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1t_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d3bz1t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1t_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 146786]}
metityvfifaciialfffaiffreppritkk

SCOPe Domain Coordinates for d3bz1t_:

Click to download the PDB-style file with coordinates for d3bz1t_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1t_: