SCOPe 2.08: Domain d1gigh1: 1gig H:1-120

Lineage for d1gigh1 (1gig H:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)

8. Domain d1gigh1: 1gig H:1-120 [19911]
   Other proteins in same PDB: d1gigh2, d1gigl1, d1gigl2
   part of Fab HC19

Details for d1gigh1

PDB Entry: 1gig, 2.3 Å

PDB Description: refined three-dimensional structure of the fab fragment of a murine igg1, lambda antibody

PDB Compounds: (H:) igg1-kappa hc19 fab (heavy chain)

SCOPe Domain Sequences for d1gigh1:

Sequence; same for both SEQRES and ATOM records:

>d1gigh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv

Timeline for d1gigh1:

• d1gigh1 first appeared (with stable ids) in SCOP 1.55
  
• d1gigh1 appears in SCOPe 2.07