Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
Protein Elongation factor 2 (eEF-2), domain IV [82575] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries) Uniprot P32324 |
Domain d3b8he4: 3b8h E:561-725 [199073] Other proteins in same PDB: d3b8ha1, d3b8ha2, d3b8ha3, d3b8ha5, d3b8hb1, d3b8hb2, d3b8hc1, d3b8hc2, d3b8hc3, d3b8hc5, d3b8hd1, d3b8hd2, d3b8he1, d3b8he2, d3b8he3, d3b8he5, d3b8hf1, d3b8hf2 automated match to d1n0vc3 protein/RNA complex; complexed with nad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3b8h (more details), 2.5 Å
SCOPe Domain Sequences for d3b8he4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b8he4 d.14.1.1 (E:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq
Timeline for d3b8he4:
View in 3D Domains from same chain: (mouse over for more information) d3b8he1, d3b8he2, d3b8he3, d3b8he5 |