| Class b: All beta proteins [48724] (180 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
| Family b.43.3.1: Elongation factors [50448] (11 proteins) |
| Protein Elongation factor 2 (eEF-2), domain II [82118] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) Uniprot P32324 |
| Domain d3b78c2: 3b78 C:344-481 [199036] Other proteins in same PDB: d3b78a1, d3b78a3, d3b78a4, d3b78a5, d3b78b1, d3b78b2, d3b78c1, d3b78c3, d3b78c4, d3b78c5, d3b78d1, d3b78d2, d3b78e1, d3b78e3, d3b78e4, d3b78e5, d3b78f1, d3b78f2 automated match to d1n0vc1 protein/RNA complex; complexed with nad |
PDB Entry: 3b78 (more details), 2.5 Å
SCOPe Domain Sequences for d3b78c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b78c2 b.43.3.1 (C:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm
Timeline for d3b78c2:
View in 3DDomains from same chain: (mouse over for more information) d3b78c1, d3b78c3, d3b78c4, d3b78c5 |