Lineage for d1mfa_2 (1mfa 251H-367H)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219943Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries)
  8. 219945Domain d1mfa_2: 1mfa 251H-367H [19889]
    Fv fragment only
    complexed with abe, gal, mma

Details for d1mfa_2

PDB Entry: 1mfa (more details), 1.7 Å

PDB Description: structure of a single-chain fv fragment complexed with a carbohydrate antigen at 1.7 angstroms resolution

SCOP Domain Sequences for d1mfa_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfa_2 b.1.1.1 (251H-367H) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
evqvqqsgtvvarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstttaymelssltsedsavyyctrgghgyygdywgqgasltvs

SCOP Domain Coordinates for d1mfa_2:

Click to download the PDB-style file with coordinates for d1mfa_2.
(The format of our PDB-style files is described here.)

Timeline for d1mfa_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfa_1