Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries) |
Domain d1mfa_2: 1mfa 251H-367H [19889] Fv fragment only complexed with abe, gal, mma |
PDB Entry: 1mfa (more details), 1.7 Å
SCOP Domain Sequences for d1mfa_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfa_2 b.1.1.1 (251H-367H) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain} evqvqqsgtvvarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy nhkfraktkltavtstttaymelssltsedsavyyctrgghgyygdywgqgasltvs
Timeline for d1mfa_2: